September 26th until October 13th Paint deals up to 30 discount We are celebrating with savings Curtains Available in several colors and sizes PVC Wall panels 16 x 290 cm Available in 3 trendy colors On selected fans 15 discount Starting at 39 99 29 99 On all curtains 25 discount or 1200 Fun Miles 100074037 Price p panel 59 99 or 2400 Fun Miles 100076097 New kooymanbv com
2 Home Rod set Barbados L 180 cm Available in white lacq brown and natural wood New 64 99 or 2600 Fun Miles 100074661 Rod set Curacao L 200 cm Available in white white lacq gray matt black and natural wood 79 99 or 3200 Fun Miles 100074667 Rod set Aruba Available in L 200 cm and L 250 cm Available in white lacq and matt black wood Rod set Bonaire L 200 cm Available in black natural wood Starting at 99 99 or 4000 Fun Miles 100074669 Proud to be by your side for years 99 99 or 4000 Fun Miles 100074673
Curtain Leafy 140 x 240 cm 44 99 33 74 or 1350 Fun Miles 100011837 Curtain Terraza 140 x 240 cm Voile 39 99 29 99 or 1200 Fun Miles 100067201 Curtain Obscure 140 x 260 cm Available in several colors 49 99 37 49 or 1500 Fun Miles 100061949 Home 3 On all curtains 25 discount Curtain Twily 135 x 260 cm Available in several colors 39 99 29 99 or 1200 Fun Miles 100074037 Curtain Chinea 135 x 240 cm Available in several colors 49 99 37 49 or 1500 Fun Miles 100061945 Curtain Blue Garden 140 x 260 cm 44 99 33 74 or 1350 Fun Miles 100061954 Curtain Golden Sunset 140 x 240 cm 59 99 44 99 or 1800 Fun Miles 100061976 kooymanbv com
4 Roller outdoor sun screen Available in L 2 H 3 meter and L 2 4 H 3 meter Available in champagne and tierra Starting at 229 99 or 9200 Fun Miles 100069982 100069984 Home Protect your outdoor furniture from sun and rain The fabric is made of 70 vinyl and 30 polyester and offers a stylish ambiance that allows air circulation while reducing heat The fabric enhances your privacy It is sun and moisture resistant and has an anti mildew effect It also blocks up to 97 of UV rays providing optimal OOOUUUTTTDDDOOO OOOSSRRSRuupaunrondnnteoBBBcuttidSoLSLSLonocfIccrIoIfrrNurryNNreoneeuDiterDDueefraneSmnSn Sily TaaHTrnhHTehdeeHTheehahmdeeaveemauvemyavyrmt evay eadtdy betluadua tlblteudaltyrcy ltcuaoycotcaomamyknanmepndpdtpodosddonnduuneeurrennaarnattbbsstbllsee lebb brraraaccckkkeeettstss aaarreree fact5o r fdaector de Caf Caf RB L IB NL ID NS D S IhtyOtNiIoottaONiIwttouuONiIrcnottouacoroorodpuwcrooiprwmbesreolpmekwieeealrrmieiesfarreansifomaaearsrowyftsdearysntsoereteytsscoidtrscoatecs aotrcohobrsahlwbroworrclbdcaawlderihwecihltdlntlceeihahetahetltiroesiahossitrnaansaosimsnrnsarssdgodgorskaadgoeeeellallrreenlnsseleruunsiitteuggpiplltnngeennplneeenaaceciiaeennsscrirendsdadradCCdadeneCnhdehnddkdhkdiodiko l liohdwh dlwhdwaaanaannannn nnd nd dddldellePePPtetehtethht at sa atssattamafmmeffeea aa k kkeeesss ATnThdThehetehheaharahrddrawdwrwdaawrareeraearaetatttathhttheeebbbooottttotoommmiissiswwwiininnddd r rereesssisiisstattaannnttt ththtehtahbatatopttprtpreoervmevevenienstntswstsbbinblliidnlnind ddsssffrrfoorommmssswwwiinningTggiiininengrgg r a resistant that prevents blinds from swinging Proud to be by your side for years
Vases Recycled glass Available in several sizes shapes and colors Home 5 On all Guan Rioja and Kyara vases 15 discount Starting at 44 99 or 1800 Fun Miles 100063372 Artificial plants Mix Match Combine pots and vases with artificial plants or flowers Starting at 15 98 or 639 Fun Miles 100056393 Scan here for all Mica products Pots Starting at 19 99 or 800 Fun Miles 100056401 kooymanbv com
6 Paint Woodluxe brightener neutralizer 1 gallon Restores weathered wood Bleach free formula Woodluxe cleaner 1 gallon Ideal for maintenance cleaning Removes mold mildew stains 99 99 79 99 20 discount or 3200 Fun Miles 100073975 Woodluxe restorer 1 gallon Restores weathered wood Bleach free formula 99 99 79 99 20 discount or 3200 Fun Miles 100073976 Woodluxe stain remover 1 gallon Removes latex oil finishes Fast acting 109 99 87 99 20 discount or 3520 Fun Miles 100073973 129 99 103 20 99 discount or 4160 Fun Miles 100073974 Paint wood with precision Surface preparation Apply to a clean dry and absorbent wood substrate New wood 1 Sand or treat with Woodluxe Brightener neutralizer 2 Allow the wood to dry then test for penetration by applying a few drops of water Weathered wood 1 Remove loose or damaged wood fibers 2 Treat with Woodluxe Wood Restorer until all loose or damaged wood fibers are removed Un weathered wood 1 Wash with Woodluxe Wood Cleaner 2 Rinse with a strong stream to remove surface salts Previously stained surfaces 1 For optimal results remove previous coatings with Woodluxe Wood Stain Remover 2 Remove contaminants or chalky residue with Woodluxe Wood Cleaner and allow to dry thoroughly 3 If the existing stain is flaking or peeling it should be removed prior to staining Everything you need to succeed
Paint 7 Helps to protect and beautify decks porches fences furniture Woodluxe stain sealer oil based 1 gallon Advanced all weather protection Penetrating oils enhace wood grain Provides UV and mildew resistant coating Woodluxe stain sealer water based 1 gallon Advanced all weather protection Resists cracking peeling Provides UV and mildew resistant coating On all sheens and colors 159 99 127 20 99 discount or 5120 Fun Miles 100073708 On all sheens and colors 159 99 127 20 99 discount or 5120 Fun Miles 100073694 kooymanbv com
8 Paint Create perfection Refresh your exterior walls make a lasting impression Kooyman wall paint Colortex Exterior 1 gallon Excellent weather resistance Dirt repellent and washable Good color retention For indoor and outdoor use Starting at 49 99 39 99 20 discount or 1600 Fun Miles 100024684 Proud to be by your side for years Kooyman wall paint Colortex A high quality elastic acrylic wallpaint suitable for brickand plasterwork concrete aerated concrete and plaster Very good hiding coverage
Benjamin Moore wall sealer Ultra Spec Masonry 1 gallon Reduces the porosity of masonry surfaces Provides excellent surface adhesion Sheen will vary due to surface texture and porosity For commercial and residential applications Paint 9 Kooyman wall sealer good covering power 1 gallon Prevents peeling and blistering Excellent adhesive properties on powdering substrates Light pigmented Suitable for mansonry and plasterwork hardboard concrete and drywall 69 99 48 30 99 discount or 1960 Fun Miles 100027269 Why use a primer before painting Fewer topcoats are needed Better adhesion Great durability of the topcoat Provides a smooth surface Extra surface protection Budget wall sealer White Basic primer for walls that need to be repainted Provides good hiding coat for previously painted walls 57 99 46 20 39 discount or 1856 Fun Miles 100031649 Benjamin Moore wall paint primer Regal Select 1 gallon Paint and primer all in 1 Excellent flow leveling and covers imperfections in less coats Durable finish stands up to repeated washing Low VOC s Starting at 174 98 148 73 On all sheens 15 discount or 5949 Fun Miles 100039514 Kooyman wall paint Whitex 1 gallon Classic white interior paint in flat finish Minimizes surface imperfections Great coverage low spatter quick dry 1 gallon 29 99 or 1200 Fun Miles 100031532 5 gallon 114 99 or 4600 Fun Miles 100031534 44 99 38 24 15 discount or 1530 Fun Miles 100038474 kooymanbv com
10 Paint Appliance epoxy white 12 oz Coating high heat 2000 f flat black 12 oz Marking paint waterbased fluorescent orange 17 oz 29 99 25 49 15 discount or 1020 Fun Miles 100028397 Bright coat metallic finish gold 11 oz 34 99 29 74 15 discount or 1190 Fun Miles 100073586 Paint primer 2x ultra cover gloss white 12 oz 24 99 21 24 15 discount or 850 Fun Miles 100032810 Galvanizing compound cold gray 20 oz 28 99 24 64 15 discount or 986 Fun Miles 100013899 22 99 19 54 15 discount or 781 Fun Miles 100002236 31 99 27 19 15 discount or 1088 Fun Miles 100037723 K Paymakes it possible Get it today with K Pay What documents do you need Valid identification ID card driver s license or passport 2 latest pay slips not older than 3 months 2 latest bank statements same period as pay slips Job letter not older than 3 months Proof of address e g most recent utility bill Fun Miles card Don t have one We ll get you one on the spot Opening hours of the Customer Finance Desk Monday to Friday from 8 am till 5 pm Saturdays and Sundays closed Proud to be by your side for years Why wait Apply now It s easy Just drop by the Customer Finance Desk for a tailor made offer The duration of the installment period can vary from 12 to 36 months K Pay Examples of monthly installments Amount Borrowing rate APR Installments Duration Total amount payable 1000 10 12 33 00 36 1182 00 2500 10 12 81 00 36 2955 00 5000 10 12 162 00 36 5909 00 based on an installment period of 36 months Annual Percentage Rate
Paint 11 On Premier and Henry driveway and roof paint 20 discount Henry roof sealant 10 oz Doesn t bleed through reflective coatings Coats with white or tinted acrylic coating Henry Roof Sealant is a white elastomeric acrylic patching compound specially formulated for repairing and preventing roof leaks prior to coating with an acrylic reflective coating Starting at 17 49 13 99 or 560 Fun Miles 100051417 Henry roof coating elastomeric 5 gallon Reduces AC wear and tear Lowers roof and interior temperatures Better durability weather protection Henry roof coating solar flex 5 gallon Applies to dry or damp surfaces Coats with white or tinted acrylic coating Doesn t bleed through reflective coatings Premier foundation coating 5 gallon Asphalt emulsion For spray or brush application No odor soap and water cleanup 390 00 312 00 or 12480 Fun Miles 100022352 329 99 263 99 or 10560 Fun Miles 100035341 99 99 79 99 or 3200 Fun Miles 100038584 kooymanbv com
12 Outdoor Bentley seeds Your budget friendly essentials K hand spray gun 1 2 4 piece set New 4 99 3 74 or 150 Fun Miles 100005504 25 discount Starting at 14 99 or 600 Fun Miles 100074966 100074965 Cutter Eclipse mosquito repellent Refill and USB charging cable included Bird bath 24 8 x 9 cm Cement Planter Resin Gray stone look H 34 3 L 40 6 W 40 6 cm 89 99 67 49 25 discount or 2700 Fun Miles 100073109 Cutter Eclipse repellent refill Works 40 hours 39 99 29 99 25 discount or 1200 Fun Miles 100073110 12 99 or 520 Fun Miles 100077560 Torch Copper steel 14 cm 39 99 29 99 25 discount or 1200 Fun Miles 100030771 Proud to be by your side for years 89 99 or 3600 Fun Miles 100075213 Thermometers Available in different models Starting at 14 99 or 600 Fun Miles 100075089
Bamboo cleaner 500 ml 34 99 26 24 25 discount or 1050 Fun Miles 100072325 Bamboo protector or renovator 1 liter 79 99 59 25 99 discount or 2400 Fun Miles 100072326 100072327 Deck box Resin Gray H 70 5 L 125 1 W 75 6 cm Outdoor 13 Bamboo split fence 200 x 500 cm 149 99 or 6000 Fun Miles 100074984 Table Banquet with folding legs 180 cm 599 99 or 24000 Fun Miles 100075197 K Pay 20 00 monthly 50 249 99 124 99 discount or 37500 Fun Miles 100074437 kooymanbv com
14 Tiles Wall panel PVC Panel size 16 x 290 cm Interior Hollow channels for cables Available in 3 trendy colors New Get more Scan to learn more Fun Miles Only at Kooyman Price p panel 59 99 or 2400 Fun Miles 100076097 Everything you need to succeed
Ceramic wall tile Polaris 45 x 90 cm Slight 3D effect Matt black gold Price p m2 39 99 or 1600 Fun Miles 100068500 Tiles 15 Ceramic tile Portugalia 19 8 x 19 8 cm Sold by box of 1 1 m2 Available in 5 designs Price p box 89 99 44 99 or 3000 Fun Miles 100064923 50 discount Tile New Boss 56 6 x 56 6 cm Porcelain bold Matt beige Price p m2 39 99 34 99 10 discount or 1400 Fun Miles 100075930 Tile Boticcino blanco 60 x 60 cm Ceramic Gray satin gloss Price p m2 32 99 24 75 25 discount or 990 Fun Miles 100064686 kooymanbv com
16 Bath Tall unit Lara Walnut 150 x 30 x 25 cm 329 99 15 discount 280 49 or 11220 Fun Miles 100075786 Bamboo rack with 2 shelves and 2 baskets Available in black and natural H 90 cm 119 99 101 99 15 discount or 4080 Fun Miles 100075316 100075317 Mirror bamboo Available in beige and brown 38 cm Vanity set Lara como Walnut 80 cm 579 99 15 discount 492 99 or 19720 Fun Miles 100075785 Bamboo rack with 2 baskets Available in black and natural H 90 cm 119 99 101 99 15 discount or 4080 Fun Miles 100075314 100075315 Scale Acacia Digital 39 99 or 1600 Fun Miles 100075318 100075324 Stool Acacia H 43 30 cm 49 99 or 2000 Fun Miles 100075319 Bathroom accessories Creme Acacia cement 59 99 or 2400 Fun Miles 100075325 Proud to be by your side for years Starting at 15 99 or 640 Fun Miles 100074230
Tall storage cabinet Bamboo black H 173 W 34 D 30 cm 249 99 199 20 99 discount or 8000 Fun Miles 100067548 Toilet Kaskada Uses 3 6 liter per flush S trap outlet 329 89 15 discount 280 49 or 11220 Fun Miles 100010992 Hand shower with hose Black PVC hose 150 cm 5 function hand shower 17 99 or 720 Fun Miles 100075326 Shower curtain Black 180 x 200 cm 39 99 or 1600 Fun Miles 100075644 Bath 17 Underlavatory cabinet Bamboo black H 70 W 60 D 30 cm 179 99 143 20 99 discount or 5760 Fun Miles 100067599 Laundry tub white H 86 W 58 D 60 cm With powder coated steel legs 7 pre cut tap holes Drain outlet size 38mm 149 99 or 6000 Fun Miles 100073427 Bath mat microfiber Black 50 x 70 cm 19 99 or 800 Fun Miles 100075327 Bathroom accessories Word Black Polyresin and bamboo Starting at 15 99 or 640 Fun Miles 100074224 kooymanbv com
18 Hardware Doors look online for all types and sizes Scan here for all our exterior doors Brown ball bearing hinge 3 5 inch Stainless steel ProSource eco combo tulip Fits doors up to 35 to 45 mm Stainless steel Also available as a combo knob deadbolt single cylinder 32 99 28 04 15 discount or 1122 Fun Miles 100018188 54 99 46 74 15 discount or 1870 Fun Miles 100022969 Proud to be by your side for years ProSource eco entry ball or tulip Fits doors up to 35 to 45 mm Stainless steel Also available as a combo knob deadbolt single cylinder Starting at 27 99 23 79 15 discount or 952 Fun Miles 100021839 100020770
Toledo hinge 3 5 inch Stainless steel Double ball cage Non removable pin Hardware 19 39 99 33 99 15 discount or 1360 Fun Miles 100058040 Toledo Jaen interior lever privacy lock Black Locks from the inside with a turn button and unlocks from the outside with a coin or flat piece of metal Easy installation with included hardware For use on interior doors where privacy locking is required 69 99 59 49 15 discount or 2380 Fun Miles 100058750 Toledo exterior leverset Barcelona lever entry Fits doors up to 35 to 45 mm Stainless steel Anti bumping cylinder Pick and pry resistant Easy installation with included hardware 64 99 55 24 15 discount or 2210 Fun Miles 100046142 Toledo exterior lock Santiago knob entry Fits doors up to 3 to 45 mm Iron black Entry or privacy Anti bumping cylinder Pick and pry resistant Easy installation with included hardware 64 99 55 24 15 discount or 2210 Fun Miles 100059078 Toledo exterior lock Malaga knob entry Fits doors up to 35 to 45 mm Stainless steel Anti bumping cylinder Pick and pry resistant Easy installation with included hardware Also available as a combo knob deadbolt single cylinder 44 99 38 24 15 discount or 1530 Fun Miles 100043981 kooymanbv com
20 Electrical Alaska air conditioner Inverter Remotely accessible via Wi Fi 50 60Hz 220 volt Available in several cooling capacities BTU 1 One year warranty on installation 2 Two years warranty on entire unit 5 Five years warranty on compressor Starting at 10 discount 849 99 K Pay 764 99 26 00 monthly or 30600 Fun Miles 100073899 Arctic King air conditioner Inverter Available in 9000 and 12000 BTU 50 60Hz 220 volt 1 1 3 One year warranty on installation One year warranty on entire unit Three years warranty on compressor Wi Fi accessible Starting at 699 99 or 28000 Fun Miles 100073903 K Pay 24 00 monthly Bracket split unit Compatible with 9000 and 12000 BTU A C Also available for 18000 and 24000 BTU A C Installation has to be done by a company selected by Kooyman Starting at 101 94 86 65 15 discount or 3466 Fun Miles 100038765 Proud to be by your side for years Airconditioning installation service
Tower fan with remote 120 volt H 48 inch 3 speeds Widespread oscillation for full room coverage 149 99 127 49 15 discount or 5100 Fun Miles 100074397 Fan wind machine 120 volt 3 speeds 20 inch 129 99 110 49 15 discount or 4420 Fun Miles 100042486 Ceiling fan turbo swirl 110 volt 60 Hz 6 blades 3 speeds 30 inch 249 17 212 49 15 discount or 8500 Fun Miles 100016665 Lighting 21 Tower fan with remote 120 volt H 38 inch 4 speeds Widespread oscillation for full room coverage 139 99 118 99 15 discount or 4760 Fun Miles 100074395 Pedestal fan Elegance 120 volt 3 speeds 18 inch 139 99 118 99 15 discount or 4760 Fun Miles 100036597 Ceiling fan Rebel III 110 volt 60 Hz 3 blades 3 speeds 56 inch 239 99 15 discount 203 99 or 8160 Fun Miles 100016657 kooymanbv com
22 Frilec oven hot air 60 cm 70 liter 220 volt Cold door construction Defrost function Kitchen Cooktop deluxe 90 cm 220 volt 50 Hz Gas Stainless steel Smeg cooker 90 cm 220 volt Built in 60 cm with 54 liter capacity Electric oven 5 oven functions with grill K Pay 33 00 monthly 1299 99 974 25 99 discount or 39000 Fun Miles 100030683 K Pay 32 00 monthly 1299 99 949 25 99 discount or 38000 Fun Miles 100036958 15 discount 3599 99 K Pay 2999 99 99 00 monthly or 120000 Fun Miles 100045329 Brugmann tosti and panini maker 110 volt Non stick plates 69 99 or 2800 Fun Miles 100068325 Bruggman electric panini grill 110 volt Non stick plates Opens 90 and 180 degrees flat Easy to clean 139 99 or 5600 Fun Miles 100057926 Brugmann oven toaster 110 volt 12 liters 99 99 or 4000 Fun Miles 100061147 Everything you need to succeed Brugmann electric oven 110 volt 25 liters 4 preset cooking programs 229 99 or 9200 Fun Miles 100065379
Hanging lamp Loren Bamboo 60 x 25 cm 40W E27 Excl bulb 199 99 or 8000 Fun Miles 100069274 Hanging lamp Hyacint Hyacint and iron 38 H 36 cm 40W E27 Excl bulb 199 99 or 8000 Fun Miles 100059767 Always more HanginglampKita Rattan and iron Fun Miles 38 H32cm 40W E27 at Excl bulb Kooyman 179 99 or 7200 Fun Miles 100063683 Table lamp Kita Rattan and iron 26 H 48 cm 230 volt 40W E27 Excl bulb 199 99 or 8000 Fun Miles 100063689 Lighting 23 Hanging lamp Jilly Available in black and natural Paper and iron 29 H 26 cm 40W E27 Excl bulb 89 99 or 3600 Fun Miles 100074933 100059616 Hanging lamp Elis Bamboo 41 5 H 66 cm 40W E27 Excl bulb 189 99 or 7600 Fun Miles 100072905 Wall lamp Jilly Natural rope black H 26 5 B 19 0 D 26 5 230 volt 40W E27 Excl bulb 69 99 or 2800 Fun Miles 100072906 Wall lamp Tea Rattan and iron 34 cm 230 volt 60W E27 Excl bulb 69 99 or 2800 Fun Miles 100074935 kooymanbv com
24 Tumbler pet themes 20 oz Available in several designs 49 99 or 2000 Fun Miles 100075742 Cat scratch tunnel 21 x 19 cm 4th of October World Animal Day Pet toys cat feed bowl duo Pet car seat cover 155 x 104 cm Pet toys Scan here for all pet products 24 99 or 1000 Fun Miles 100077549 Cat scratch post 4 99 or 200 Fun Miles 100070046 Dog running leash with belt Available in 3 colors 39 99 or 1600 Fun Miles 100077553 Dog collar Available in 3 colors Starting at 2 99 or 120 Fun Miles 100077550 Pet cooling gel mat 60 cm 69 99 or 2800 Fun Miles 100077536 19 99 or 800 Fun Miles 100077552 9 99 or 400 Fun Miles 100070029 24 99 or 1000 Fun Miles 100077538 Santa Rosa Monday Saturday 08 00 am 06 00 pm Sunday 09 00 am 01 00 pm Zeelandia Jan Noorduynweg Monday Saturday 07 00 am 07 00 pm Sunday 09 00 am 02 00 pm All prices include taxes and are in Antillian Guilders Prices are valid from September 26th until October 13th 2024 or while supplies last Kooyman reserves the right to correct printing errors and prices may change if there are extreme variations Items may vary from illustrations Contact our info desk for shipping and delivery info kooymanbv com