Return to flip book view

COPY Kooyman Brochure Barbados

Page 1

September 26th until October 13th Paint deals up to 30 discount We are celebrating with savings Curtains Available in several colours and sizes On selected fans 15 discount Starting at 49 99 37 49 On all curtains 25 discount or 375 Massy Points 100074037 PVC Wall panels 16 x 290 cm Available in 3 trendy colours Price p panel 69 99 or 700 Massy Points 100076097 New kooyman bb

Page 2

2 Home Rod set Barbados L 71 inch Available in white lacq brown and natural wood New 84 99 or 850 Massy Points 100074661 Rod set Curacao L 78 7 inch Available in white white lacq grey matt black and natural wood 99 99 or 1000 Massy Points 100074667 Rod set Aruba Available in L 78 7 inch and L 98 4 inch Available in white lacq and matt black wood Rod set Bonaire L 78 7 inch Available in black natural wood Starting at 129 99 or 1300 Massy Points 100074669 Proud to be by your side for years 129 99 or 1300 Massy Points 100074673

Page 3

Curtain Eden 55 1 x 102 4 inch 64 99 48 74 or 487 Massy Points 100074038 Curtain Terraza 55 1 x 94 5 inch Voile 49 99 37 49 or 375 Massy Points 100067201 Curtain Obscure 55 1 x 102 4 inch Available in several colours 54 99 41 24 or 412 Massy Points 100061949 Home 3 On all curtains 25 discount Curtain Twily 53 1 x 102 4 inch Available in several colours 49 99 37 49 or 375 Massy Points 100074037 Curtain Chinea 53 1 x 94 5 inch Available in several colours 54 99 41 24 or 412 Massy Points 100061945 Curtain Blue Garden 55 1 x 102 4 inch 49 99 37 49 or 375 Massy Points 100061954 Curtain Golden Sunset 55 1 x 94 5 inch 69 99 52 49 or 525 Massy Points 100061976 kooyman bb

Page 4

4 Roller outdoor sun screen Available in L 2 H 3 meter and L 2 4 H 3 meter Available in champagne and tierra Starting at 324 99 or 3250 Massy Points 100069982 100069984 Home Protect your outdoor furniture from sun and rain The fabric is made of 70 vinyl and 30 polyester and offers a stylish ambiance that allows air circulation while reducing heat The fabric enhances your privacy It is sun and moisture resistant and has an anti mildew effect It also blocks up to 97 of UV rays providing optimal OOOUUUTTTDDDOOO OOOSSRRSRuupaunrondnnteoBBBcuttidSoLSLSLonocfIccrIoIfrrNurryNNreoneeuDiterDDueefraneSmnSn Sily TaaHTrnhHTehdeeHTheehahmdeeaveemauvemyavyrmt evay eadtdy betluadua tlblteudaltyrcy ltcuaoycotcaomamyknanmepndpdtpodosddonnduuneeurrennaarnattbbsstbllsee lebb brraraaccckkkeeettstss aaarreree fact5o r fdaector de Caf Caf RB L IB NL ID NS D S IhtyOtNiIoottaONiIwttouuONiIrcnottouacoroorodpuwcrooiprwmbesreolpmekwieeealrrmieiesfarreansifomaaearsrowyftsdearysntsoereteytsscoidtrscoatecs aotrcohobrsahlwbroworrclbdcaawlderihwecihltdlntlceeihahetahetltiroesiahossitrnaansaosimsnrnsarssdgodgorskaadgoeeeellallrreenlnsseleruunsiitteuggpiplltnngeennplneeenaaceciiaeennsscrirendsdadradCCdadeneCnhdehnddkdhkdiodiko l liohdwh dlwhdwaaanaannannn nnd nd dddldellePePPtetehtethht at sa atssattamafmmeffeea aa k kkeeesss ATnThdThehetehheaharahrddrawdwrwdaawrareeraearaetatttathhttheeebbbooottttotoommmiissiswwwiininnddd r rereesssisiisstattaannnttt ththtehtahbatatopttprtpreoervmevevenienstntswstsbbinblliidnlnind ddsssffrrfoorommmssswwwiinningTggiiininengrgg r a resistant that prevents blinds from swinging Proud to be by your side for years

Page 5

Vases Recycled glass Available in several sizes shapes and colours Home 5 On all Guan Rioja and Kyara vases 15 discount Starting at 59 99 or 600 Massy Points 100063372 Artificial plants Mix Match Combine pots and vases with artificial plants or flowers Starting at 18 99 or 190 Massy Points 100056393 Scan here for all Mica products Pots Starting at 16 99 or 170 Massy Points 100056401 kooyman bb

Page 6

6 Paint Woodluxe brightener neutralizer 1 gallon Restores weathered wood Bleach free formula Woodluxe cleaner 1 gallon Ideal for maintenance cleaning Removes mold mildew stains 99 99 79 99 20 discount or 800 Massy Points 100073975 Woodluxe restorer 1 gallon Restores weathered wood Bleach free formula 99 99 79 99 20 discount or 800 Massy Points 100073976 Woodluxe stain remover 1 gallon Removes latex oil finishes Fast acting 109 99 87 99 20 discount or 880 Massy Points 100073973 129 99 103 20 99 discount or 1040 Massy Points 100073974 Paint wood with precision Surface preparation Apply to a clean dry and absorbent wood substrate New wood 1 Sand or treat with Woodluxe Brightener neutralizer 2 Allow the wood to dry then test for penetration by applying a few drops of water Weathered wood 1 Remove loose or damaged wood fibers 2 Treat with Woodluxe Wood Restorer until all loose or damaged wood fibers are removed Un weathered wood 1 Wash with Woodluxe Wood Cleaner 2 Rinse with a strong stream to remove surface salts Previously stained surfaces 1 For optimal results remove previous coatings with Woodluxe Wood Stain Remover 2 Remove contaminants or chalky residue with Woodluxe Wood Cleaner and allow to dry thoroughly 3 If the existing stain is flaking or peeling it should be removed prior to staining Everything you need to succeed

Page 7

Paint 7 Helps to protect and beautify decks porches fences furniture Woodluxe stain sealer oil based 1 gallon Advanced all weather protection Penetrating oils enhace wood grain Provides UV and mildew resistant coating Woodluxe stain sealer water based 1 gallon Advanced all weather protection Resists cracking peeling Provides UV and mildew resistant coating On all sheens and colours 164 99 131 20 99 discount or 1320 Massy Points 100073708 On all sheens and colours 164 99 131 20 99 discount or 1320 Massy Points 100073694 kooyman bb

Page 8

8 Paint Create perfection Refresh your exterior walls make a lasting impression Kooyman wall paint Colortex Exterior 1 gallon Excellent weather resistance Dirt repellent and washable Good colour retention For indoor and outdoor use Starting at 79 99 63 99 20 discount or 640 Massy Points 100024684 Proud to be by your side for years Kooyman wall paint Colortex A high quality elastic acrylic wallpaint suitable for brickand plasterwork concrete aerated concrete and plaster Very good hiding coverage

Page 9

Benjamin Moore wall sealer Ultra Spec Masonry 1 gallon Reduces the porosity of masonry surfaces Provides excellent surface adhesion Sheen will vary due to surface texture and porosity For commercial and residential applications Paint 9 Benjamin Moore interior latex paint Scuff X 1 gallon Superior durability and scuff resistance Washable Quick dry Great touch up 74 99 52 49 30 discount or 525 Massy Points 100027269 Why use a primer before painting Fewer topcoats are needed Better adhesion Great durability of the topcoat Provides a smooth surface Extra surface protection Budget wall sealer White Basic primer for walls that need to be repainted Provides good hiding coat for previously painted walls 169 99 30 118 99 discount or 1190 Massy Points 100017847 Kooyman wall sealer good covering power 1 gallon Prevents peeling and blistering Excellent adhesive properties on powdering substrates Light pigmented Suitable for mansonry and plasterwork hardboard concrete and drywall 52 99 42 39 20 discount or 424 Massy Points 100031649 Budget wall paint 1 gallon White Flat 1 gallon 43 99 or 440 Massy Points 100031532 5 gallon 159 99 or 1600 Massy Points 100031534 43 99 or 440 Massy Points 100050918 kooyman bb

Page 10

10 Paint Appliance epoxy white 12 oz Coating high heat 2000 f flat black 12 oz Marking paint waterbased fluorescent orange 17 oz 32 00 27 20 15 discount or 272 Massy Points 100028397 Bright coat metallic finish gold 11 oz 26 99 22 94 15 discount or 229 Massy Points 100073586 Paint primer 2x ultra cover gloss white 12 oz 22 99 19 54 15 discount or 195 Massy Points 100032810 Galvanizing compound cold grey 20 oz 32 00 27 20 15 discount or 272 Massy Points 100013899 19 99 16 99 15 discount or 170 Massy Points 100002236 39 99 33 99 15 discount or 340 Massy Points 100037723 K Paymakes it possible Get it today with K Pay Why wait Apply now It s easy Just drop by the Customer Finance Desk for a tailor made offer What documents do you need Valid identification ID card driver s license or passport 3 latest pay slips not older than 3 months 3 latest bank statements same period as pay slips Job letter not older than 3 months Proof of address e g most recent utility bill Massy card Don t have one We ll get you one on the spot Opening hours of the Customer Finance Desk Monday to Friday from 8 am till 5 pm Saturdays and Sundays closed Proud to be by your side for years The duration of the instalment period can vary from 12 to 36 months K Pay Examples of monthly installments Amount 1000 2500 5000 Borrowing rate 12 12 12 Instalments 34 00 84 00 167 00 based on an installment period of 36 months Duration 36 months 36 months 36 months

Page 11

Paint 11 On Premier and Henry driveway and roof paint 20 discount Henry roof sealant 10 oz Doesn t bleed through reflective coatings Coats with white or tinted acrylic coating Henry Roof Sealant is a white elastomeric acrylic patching compound specially formulated for repairing and preventing roof leaks prior to coating with an acrylic reflective coating Starting at 16 99 13 59 or 136 Massy Points 100051417 Henry roof coating elastomeric 5 gallon Reduces AC wear and tear Lowers roof and interior temperatures Better durability weather protection Henry roof coating solar flex 5 gallon Applies to dry or damp surfaces Coats with white or tinted acrylic coating Doesn t bleed through reflective coatings Premier foundation coating 5 gallon Asphalt emulsion For spray or brush application No odor soap and water cleanup 399 99 319 99 or 3200 Massy Points 100022352 329 99 263 99 or 2640 Massy Points 100035341 129 99 103 99 or 1040 Massy Points 100038584 kooyman bb

Page 12

12 Outdoor Cutting pots round H 2 8 3 5 inch 8 pieces Bentley seeds 7 99 or 80 Massy Points 100058431 Planter Resin Grey stone look H 13 5 L 16 0 W 16 0 inch 4 99 3 74 25 discount or 37 Massy Points 100005504 Bird bath 9 8 x 3 5 inch Cement 99 99 or 1000 Massy Points 100075213 Window thermometer salamander RVS Thermometer Galilei Plastic 18 3 x 4 3 inch 14 99 or 150 Massy Points 100077560 Torch Copper steel 5 5 inch 24 99 or 250 Massy Points 100075088 Torch bamboo Konai 5 ft Fiberglass 44 99 33 74 25 discount or 338 Massy Points 100030771 24 99 21 24 15 discount or 212 Massy Points 100026445 Proud to be by your side for years 16 99 or 170 Massy Points 100075089 Torch citronella 64 oz Fuel 39 99 or 400 Massy Points 100001626

Page 13

Outdoor 13 Your budget friendly essentials Bamboo split fence 200 x 500 cm K hand spray gun 1 2 4 piece set New Starting at 16 99 or 170 Massy Points 100074966 100074965 Deck box Resin Grey H 27 8 x L 49 3 x W 29 8 inch 159 99 or 1600 Massy Points 100074984 Cutter Eclipse mosquito repellent refill Works 40 hours 749 99 or 7500 Massy Points 100075197 54 99 41 24 25 discount or 412 Massy Points 100073110 kooyman bb

Page 14

14 Tiles Wall panel PVC Panel size 6 25 x 114 17 inch Interior Hollow channels for cables Available in 3 trendy colours New Get more Massy Points Scan to learn more Only at Kooyman Price p panel 69 99 or 700 Massy Points 100076097 EPvroeruydthtiongbeyobuynyeoeudrtsoidseucfcoered years

Page 15

Tiles 15 Ceramic wall tile Polaris 18 x 36 inch Slight 3D effect Matt black gold Price p tile 18 99 or 190 Massy Points 100068500 Ceramic tile Portugalia 8 x 8 inch Sold by box of 11 84 ft2 Available in 5 designs Price p box 119 99 99 99 15 discount or 1000 Massy Points 100064923 Tile New Boss 22 3 x 22 3 inch Porcelain bold Matt beige Price p tile 16 99 13 99 10 discount or 140 Massy Points 100075930 Tile Beach grey or Brescia White 22 3 x 22 3 inch Porcelain bold Price p tile 16 99 13 99 10 discount or 140 Massy Points 100075927 100075929 kooyman bb

Page 16

16 Toilet Kaskada P trap Economical flushing 3 6L 349 99 297 49 15 discount or 2975 Massy Points 100061258 Mirror bamboo Available in beige and brown 15 inch Bath Bamboo rack with 2 shelves and 2 baskets Available in black and natural H 35 4 inch 119 99 110 49 15 discount or 1105 Massy Points 100075316 100075317 Bamboo rack with 2 baskets Available in black and natural H 35 4 inch 119 99 110 49 15 discount or 1105 Massy Points 100075314 100075315 Scale Acacia Digital 44 99 or 450 Massy Points 100075318 100075324 Stool Acacia H 16 9 11 8 inch 49 99 or 500 Massy Points 100075319 Bathroom accessories Creme Acacia cement 59 99 or 600 Massy Points 100075325 Proud to be by your side for years Starting at 16 99 or 170 Massy Points 100074230

Page 17

Tall storage cabinet Bamboo black H 68 1 W 13 4 D 11 8 inch 279 99 223 20 99 discount or 2240 Massy Points 100067548 Toilet Modern P trap USA 399 99 or 4000 Massy Points 100074272 Shower fixed Koral black 339 99 or 3340 Massy Points 100064245 Shower curtain Black 70 9 x 78 7 inch 42 99 or 430 Massy Points 100075644 Bath 17 Underlavatory cabinet Bamboo black H 27 6 W23 6 D 11 8 inch 199 99 159 20 99 discount or 1600 Massy Points 100067599 Laundry tub white H 33 9 W 22 8 D 23 6 inch With powder coated steel legs 7 pre cut tap holes Drain outlet size 1 5 159 99 or 160 Massy Points 100073427 Bath mat microfiber Black 19 7 x 27 6 inch 24 99 or 250 Massy Points 100075327 Bathroom accessories Word Black Polyresin and bamboo Starting at 15 99 or 160 Massy Points 100074224 kooyman bb

Page 18

18 Hardware Doors look online for all types and sizes Scan here for all our exterior doors Brown ball bearing hinge 3 5 inch Stainless steel ProSource eco combo tulip Fits doors up to 35 to 45 mm Stainless steel Also available as a combo knob deadbolt single cylinder 44 99 38 24 15 discount or 382 Massy Points 100018188 59 99 50 99 15 discount or 510 Massy Points 100022969 Proud to be by your side for years ProSource eco entry ball or tulip Fits doors up to 35 to 45 mm Stainless steel Also available as a combo knob deadbolt single cylinder 34 99 29 74 15 discount or 298 Massy Points 100021839 100020770

Page 19

Hardware 19 Toledo hinge 3 0 inch Stainless steel Durable and easy to use Ball bearing provide for a smooth precision movement Non removable pin 34 99 29 74 15 discount or 298 Massy Points 100058038 Toledo Jaen interior lever privacy lock Black Locks from the inside with a turn button and unlocks from the outside with a coin or flat piece of metal Easy installation with included hardware For use on interior doors where privacy locking is required Toledo exterior lock Santiago knob entry Fits doors up to 3 to 45 mm Iron black Entry or privacy Anti bumping cylinder Pick and pry resistant Easy installation with included hardware 74 99 63 74 15 discount or 638 Massy Points 100058750 Toledo exterior leverset Barcelona lever entry Fits doors up to 35 to 45 mm Stainless steel Anti bumping cylinder Pick and pry resistant Easy installation with included hardware 64 99 55 24 15 discount or 552 Massy Points 100046142 74 99 63 74 15 discount or 638 Massy Points 100059078 Toledo exterior lock Malaga knob entry Fits doors up to 35 to 45 mm Stainless steel Anti bumping cylinder Pick and pry resistant Easy installation with included hardware Also available as a combo knob deadbolt single cylinder 42 99 36 54 15 discount or 366 Massy Points 100043981 kooyman bb

Page 20

20 Alaska air conditioner Inverter Remotely accessible via Wi Fi 50 60Hz 220 volt Available in various BTUs Free bracket Starting at 10 discount 1299 98 K Pay 1169 99 39 00 monthly or 11700 Massy Points 100073899 Arctic King air conditioner Inverter Available in 9000 and 12000 BTU 50 60Hz 220 volt Electrical 1 One year warranty on installation 2 5 Two years warranty on entire unit Five years warranty on compressor Wi Fi accessible 1 1 3 One year warranty on installation One year warranty on entire unit Three years warranty on compressor Starting at 1049 99 or 10500 Massy Points 100073903 K Pay 35 00 monthly Comfort Aire portable air conditioner 12000 BTU 115 volt Remote and window mount kit included Comfort Aire window air conditioner 8000 BTU Universal airco remote One touch function with LCD display Displays room temperature 24 hour on off timer energy savings Celsius or Fahrenheit display 1999 99 15 discount 1699 99 or 17000 Massy Points 100069978 K Pay 57 00 monthly Proud to be by your side for 999 99 K Pay 899 99 10 30 00 discount monthly or 9000 Massy Points 100073909 49 98 or 500 Massy Points 100033360 years Installation has to be done by a company selected by Kooyman

Page 21

Tower fan with remote 120 volt H 48 inch 3 speeds Widespread oscillation for full room coverage 189 99 161 49 15 discount or 1615 Massy Points 100074397 Fan wind machine 120 volt 3 speeds 20 inch 169 99 15 discount 144 49 or 1445 Massy Points 100042486 Ceiling fan turbo swirl 110 volt 60 Hz 6 blades 3 speeds 30 inch 289 99 15 discount 246 49 or 2465 Massy Points 100016665 Lighting 21 Tower fan with remote 120 volt H 38 inch 4 speeds Widespread oscillation for full room coverage 179 99 152 99 15 discount or 1530 Massy Points 100074395 Pedestal fan Elegance 120 volt 3 speeds 18 inch 169 99 15 discount 144 49 or 1445 Massy Points 100036597 Ceiling fan Rebel III 110 volt 60 Hz 3 blades 3 speeds 56 inch 269 99 15 discount 229 49 or 2295 Massy Points 100016657 kooyman bb

Page 22

22 Refrigerator freezer Nofrost 272 and 176 liter 220 volt Black Kitchen Refrigerator freezer 122 and 53 liter 220 volt 2099 25 2799 99 K Pay 99 discount 70 00 monthly or 21000 Massy Points 100075147 899 25 1199 99 K Pay 99 discount 30 00 monthly or 9000 Massy Points 100075146 Exquisit combi microwave 17 7 inch 44 liter Cold door construction Defrost function Bosch dishwasher 23 6 inch 220 volt Oven Caribe 30 inch 220 volt Electric K Pay 64 00 monthly 2399 98 20 1899 99 discount or 19000 Massy Points 100030682 10 discount 1999 99 K Pay 1799 99 60 00 monthly or 18000 Massy Points 100061235 Proud to be by your side for years K Pay 2199 99 74 00 monthly or 22000 Massy Points 100068795

Page 23

Hanging lamp Loren Bamboo 23 6 x 9 8 inch 40W E27 Excl bulb 249 99 or 2500 Massy Points 100069274 Hanging lamp Hyacint Hyacint and iron 15 0 H 14 2 inch 40W E27 Excl bulb 199 99 or 2000 Massy Points 100059767 Hanging lamp Kita Rattan and iron 15 0 H 12 6 inch 40W E27 Excl bulb 199 99 or 2000 Massy Points 100063683 Hanging lamp wire Wave Metal black 13 4 H 16 1 inch 40W E27 Excl bulb 69 99 or 700 Massy Points 100069269 Lighting 23 Hanging lamp Jilly Available in black and natural Paper and iron 11 4 x H 10 2 inch 40W E27 Excl bulb 99 99 or 1000 Massy Points 100074933 100059616 Hanging lamp Wire Metal black 7 7 H 7 7 inch 40W E27 Excl bulbs 3x 119 99 or 1200 Massy Points 100069270 Hanging lamp Jena Metal black 10 2 H 9 8 inch 40W E27 Excl bulb 89 99 or 900 Massy Points 100074934 kooyman bb

Page 24

24 Tumbler pet themes 20 oz Available in several designs 57 99 or 580 Massy Points 100075742 Cat scratch tunnel 8 3 x 7 5 inch 4th of October World Animal Day Pet toys cat feed bowl duo Pet car seat cover 61 0 x 40 9 inch Pet toys Scan here for all pet products 29 99 or 300 Massy Points 100077549 Cat scratch post 6 99 or 70 Massy Points 100070046 Dog running leash with belt Available in 3 colours 44 99 or 450 Massy Points 100077553 Dog collar Available in 3 colours Starting at 4 99 or 50 Massy Points 100077550 Pet cooling gel mat 23 6 inch 79 99 or 800 Massy Points 100077536 24 99 or 250 Massy Points 100077552 12 99 or 130 Massy Points 100070029 29 99 or 300 Massy Points 100077538 Open 7 days a week Monday Saturday 07 00 am 07 00 pm Sunday 09 00 am 05 00 pm Kooyman Barbados Christ Church Tel 1 246 434 3333 All prices include taxes and are in Bajan Dollar Prices are valid from September 26th until October 13th 2024 or while supplies last Kooyman reserves the right to correct printing errors and prices may change if there are extreme variations Items may vary from illustrations Contact our info desk for shipping and delivery info www kooyman bb